BFM 89.9

HIGHLIGHTS 
Podcast  >  Enterprise  >  Raise Your Game  >  The 8 Principles of Pragmatic Optimism

The 8 Principles of Pragmatic Optimism

Mark Stevenson, We Do Things Differently

07-Jun-16 11:00

The 8 Principles of Pragmatic Optimism

Mark Stevenson is an entrepreneur, author, broadcaster, occasional comedian and expert on global trends and innovation. He’s the founder of The League of Pragmatic Optimists, an organisation that creates meeting places in cities and towns across the globe “where people who want to make the world better can meet, generate ideas and projects, and find collaborators and have their neurons tickled in the cause of improving the story of humanity.” We catch up with Mark to find out about the 8 principles of pragmatic optimism that the league lives by.


This and more than 60,000 other podcasts in your hand. Download the all new BFM mobile app.

Categories: 

Tags:  raise your gameoptimismfearcynicismskepticismgrowth





Play / Pause

Listen now : Enterprise Explores: Dickson Woo, Country General Manager & Technology Leader, IBM Malaysia...

Today’s Shows



6:00 AM

The 6AM Stretch

Thought-provoking discussions on ideas, people and events shaping our lives.

7:00 AM

World Market Watch

Michele Schneider, Chief Strategist at Market Gauge tells us where international markets are heading.

7:15 AM

Morning Brief

We recap global and local headlines from today's papers and portals.

7:30 AM

Morning Brief

Jonathan Curtis, Co-Chief Investment Officer, Franklin Equity will be sharing the outlook of US tech stocks.

7:45 AM

Morning Brief

Firdaos Rosli, Chief Economist, Ambank gives us an outlook on Malaysia's economy.

8:00 AM

The Breakfast Grille

Shariman Yusuf Mohamed Zain, CEO of Alam Flora, shares how the company is transforming from a concession-based waste collector into a circular economy and environmental solutions player.

8:30 AM

Morning Brief

Dr. Abdul Rahman Yaacob of Verve Research explains whether the South China Sea Code of Conduct can truly keep the waters safe without resolving territorial disputes.

8:45 AM

Morning Brief

Dato' Dr. Ahmad Farhan Mohd. Sadullah, Vice Chancellor of Universiti Putra Malaysia, shares insights into the the Malaysian rail system.

9:00 AM

Opening Bell

(REPEAT) Michele Schneider, Chief Strategist at Market Gauge tells us where international markets are heading.

9:15 AM

Opening Bell

(REPEAT) We take a look at the FBM KLCI as well as regional capital markets.

9:35 AM

What's The Focus

We wrap up the week’s biggest conversations to keep you in the know.

10:05 AM

Open For Business

Thiban Chandra, Founder of TechX Malaysia shares about moving from a reservoir engineer in the oil and gas industry to launching a home audio and Hi-Fi venture.

11:00 AM

Mattsplained

Matt Armitage, Founder, Kulturpop

12:00 PM

Enterprise Explores

Dickson Woo, Country General Manager & Technology Leader, IBM Malaysia shares findings from the IBM 2026 Business and Technology Trends.

1:00 PM

The Breakfast Grille Repeat

Shariman Yusuf Mohamed Zain, CEO of Alam Flora, shares how the company is transforming from a concession-based waste collector into a circular economy and environmental solutions player.

2:05 PM

Discovery Hour

An eclectic selection of BBC shows, curated with variety in mind.

3:05 PM

Front Row

BUKA 2026 uses solo theatre and dance to explore identity, belonging, and emotional truth. We speak with producer Hoe Hui Ting and director Syafiq Syazim to find out more.

3:25 PM

Front Row

The MPO’s 28th season spans Mozart to movies, anime, and Broadway. Resident Conductor Gerard Salonga shares how the orchestra keeps classical music exciting.

4:05 PM

Health & Living

The United States is now encouraging its people to eat more protein and fats, and less carbohydrates. But why is it doing so? And what should you learn from their new guidelines?

5:00 PM

Top 5 at 5

A countdown of the 5 biggest stories of the day, to catch you up on all you need to know!

6:00 PM

Popcorn Culture

28 Years Later: The Bone Temple + Zombies on Screen

7:00 PM

Just For Kicks

8:00 PM

Bar None

9:00 PM

The Selector

Covering all styles of music from indie, dubstep, folk, soul, electro and everything in between from some of the most exciting artists in the UK.